PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G0539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 325aa    MW: 36177.9 Da    PI: 8.7587
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G0539genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.83e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g++R++k+c++rw +yl
      Gh_D01G0539 14 KGPWTAEEDQKLIDYIQKHGHGRWRTLPKNAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.72e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eEde +++++  lG++ W++Ia++++ gRt++++k++w+++
      Gh_D01G0539  67 RGKFSIEEDEVIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-26664IPR009057Homeodomain-like
PROSITE profilePS5129419.582961IPR017930Myb domain
SuperFamilySSF466893.03E-3211108IPR009057Homeodomain-like
SMARTSM007173.6E-161363IPR001005SANT/Myb domain
PfamPF002493.5E-171461IPR001005SANT/Myb domain
CDDcd001671.45E-131661No hitNo description
PROSITE profilePS5129427.39662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2765116IPR009057Homeodomain-like
SMARTSM007171.6E-1466114IPR001005SANT/Myb domain
PfamPF002496.9E-1567111IPR001005SANT/Myb domain
CDDcd001672.71E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGKPPGCDKN GLKKGPWTAE EDQKLIDYIQ KHGHGRWRTL PKNAGLKRCG KSCRLRWTNY  60
LRPDIKRGKF SIEEDEVIIQ LHSVLGNKWS AIAARLPGRT DNEIKNYWNT HIKKKLLRMG  120
IDPVTHAPRL DLLELSSLLS SSLYNSSLNP AGFVGSMFNP SFFSLATAFL SSNQTKNLEI  180
NNLAGNIQQI QNPYEPYQGN QVPVITQVSQ ADLNQFSANP GLPNLWQIDN NVSDSKGFLP  240
TTMQNINGYN HGFYLGDQNL QQVCTFSEKI PNLVPFGSLL STPSSSSTPL NNGSSTEDIE  300
RDSYCSSNNM LIFDVPKGLN VNGCM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-33121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-33121162105C-Myb DNA-Binding Domain
1msf_C2e-33121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5839566e-57JX583956.1 Gossypium hirsutum clone NBRI_GE17128 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459089.10.0PREDICTED: myb-related protein 330-like
TrEMBLA0A0D2Q9C60.0A0A0D2Q9C6_G
STRINGVIT_19s0014g03820.t011e-122(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2234145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-85MYB-like 102